GLT8D1 antibody (Middle Region)

Catalog No. ABIN635397

Product Details anti-GLT8D1 Antibody

Target: GLT8D1 (Glycosyltransferase 8 Domain Containing 1 (GLT8D1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLT8D1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLT8 D1 antibody was raised against the middle region of GLT8 1

Purification: Affinity purified

Immunogen: GLT8 D1 antibody was raised using the middle region of GLT8 1 corresponding to a region with amino acids LLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHLKPWG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLT8D1 Blocking Peptide, catalog no. 33R-5151, is also available for use as a blocking control in assays to test for specificity of this GLT8D1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLT8D1

Target: GLT8D1 (Glycosyltransferase 8 Domain Containing 1 (GLT8D1))

Alternative Name: GLT8D1 (GLT8D1 Products)

Synonyms: MSTP139 antibody, 2410004H05Rik antibody, 5430414N14Rik antibody, AI450005 antibody, Da2-24 antibody, wu:fc60b12 antibody, zgc:103525 antibody, glycosyltransferase 8 domain containing 1 antibody, glycosyltransferase 8 domain containing 1 L homeolog antibody, GLT8D1 antibody, Glt8d1 antibody, glt8d1 antibody, glt8d1.L antibody

Background: GLT8D1 is a member of the glycosyltransferase family. The specific function of this protein has not been determined. Three alternatively spliced variants encoding the same isoform have been described.

Molecular Weight: 42 kDa (MW of target protein)