DPP6 antibody (Middle Region)

Catalog No. ABIN635408

Product Details anti-DPP6 Antibody

Target: DPP6 (Dipeptidyl-Peptidase 6 (DPP6))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DPP6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DPP6 antibody was raised against the middle region of DPP6

Purification: Affinity purified

Immunogen: DPP6 antibody was raised using the middle region of DPP6 corresponding to a region with amino acids AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPP6 Blocking Peptide, catalog no. 33R-1028, is also available for use as a blocking control in assays to test for specificity of this DPP6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPP6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DPP6

Target: DPP6 (Dipeptidyl-Peptidase 6 (DPP6))

Alternative Name: DPP6 (DPP6 Products)

Synonyms: dppx antibody, DPPX antibody, VF2 antibody, DPP VI antibody, dpp6 antibody, si:ch211-198f16.1 antibody, B930011P16Rik antibody, D5Buc3 antibody, D5Buc4 antibody, D5Buc5 antibody, Dpp-6 antibody, Gm1377 antibody, In(5)6H-p antibody, Peplb antibody, Rw antibody, dipeptidyl peptidase like 6 antibody, dipeptidyl-peptidase 6 antibody, dipeptidyl-peptidase 6b antibody, dipeptidylpeptidase 6 antibody, DPP6 antibody, dpp6 antibody, BCAN_A2221 antibody, BSUIS_A2016 antibody, Bsph_2289 antibody, BMEA_A2239 antibody, dpp6b antibody, Dpp6 antibody

Background: DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.

Molecular Weight: 91 kDa (MW of target protein)