HS3ST3B1 antibody

Catalog No. ABIN635433

Product Details anti-HS3ST3B1 Antibody

Target: HS3ST3B1 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HS3ST3B1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HS3 ST3 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HS3ST3B1 Blocking Peptide, catalog no. 33R-1387, is also available for use as a blocking control in assays to test for specificity of this HS3ST3B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HS3ST3B1

Target: HS3ST3B1 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1))

Alternative Name: HS3ST3B1 (HS3ST3B1 Products)

Synonyms: 30ST3B1 antibody, 3OST3B1 antibody, 3-OST-3B antibody, 3Ost3b antibody, AU041882 antibody, AW536289 antibody, Hs3st3b antibody, m3-OST-3B antibody, zgc:152967 antibody, HS3ST3B1 antibody, heparan sulfate-glucosamine 3-sulfotransferase 3B1 antibody, heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1 antibody, heparan sulfate glucosamine 3-O-sulfotransferase 3B1 antibody, heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1b antibody, heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1a antibody, heparan sulfate glucosamine 3-O-sulfotransferase 3B1-like antibody, HS3ST3B1 antibody, Hs3st3b1 antibody, LOC489516 antibody, hs3st3b1b antibody, hs3st3b1a antibody, HS3ST3B1L antibody

Background: HS3ST3B1 is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide.

Molecular Weight: 43 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process