TRAM2 antibody (N-Term)

Catalog No. ABIN635438

Product Details anti-TRAM2 Antibody

Target: TRAM2 (Translocation Associated Membrane Protein 2 (TRAM2))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRAM2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRAM2 antibody was raised against the N terminal of TRAM2

Purification: Affinity purified

Immunogen: TRAM2 antibody was raised using the N terminal of TRAM2 corresponding to a region with amino acids MFEVTAKTAFLFILPQYNISVPTADSETVHYHYGPKDLVTILFYIFITII

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRAM2 Blocking Peptide, catalog no. 33R-5990, is also available for use as a blocking control in assays to test for specificity of this TRAM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRAM2

Target: TRAM2 (Translocation Associated Membrane Protein 2 (TRAM2))

Alternative Name: TRAM2 (TRAM2 Products)

Synonyms: C330003D03Rik antibody, wu:fb20c11 antibody, wu:fi23a12 antibody, zgc:111902 antibody, zgc:55869 antibody, zgc:76937 antibody, tram2 antibody, translocation associated membrane protein 2 antibody, tram-like protein antibody, TraM-like protein antibody, translocating chain-associating membrane protein 2 antibody, translocation associated membrane protein 2 L homeolog antibody, TRAM2 antibody, CJE0444 antibody, BT_p548215 antibody, traM antibody, CJJ81176_0418 antibody, Tram2 antibody, tram2 antibody, tram2.L antibody

Background: TRAM2 is a component of the translocon, a gated macromolecular channel that controls the posttranslational processing of nascent secretory and membrane proteins at the endoplasmic reticulum (ER) membrane.

Molecular Weight: 43 kDa (MW of target protein)