RHBDL2 antibody

Catalog No. ABIN635453

Product Details anti-RHBDL2 Antibody

Target: RHBDL2 (Rhomboid, Veinlet-Like 2 (RHBDL2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHBDL2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RHBDL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RHBDL2 Blocking Peptide, catalog no. 33R-4732, is also available for use as a blocking control in assays to test for specificity of this RHBDL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHBDL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RHBDL2

Target: RHBDL2 (Rhomboid, Veinlet-Like 2 (RHBDL2))

Alternative Name: RHBDL2 (RHBDL2 Products)

Synonyms: RRP2 antibody, 9130416B15 antibody, rhomboid like 2 antibody, rhomboid, veinlet-like 2 (Drosophila) antibody, RHBDL2 antibody, Rhbdl2 antibody

Background: RHBDL2 is a member of the rhomboid family of integral membrane proteins. This family contains proteins that are related to Drosophila rhomboid protein. Members of this family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases. RHBDL2 is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3.

Molecular Weight: 34 kDa (MW of target protein)