KIRREL antibody

Catalog No. ABIN635461

Product Details anti-KIRREL Antibody

Target: KIRREL (NEPH1) (Kin of IRRE Like 1 (NEPH1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIRREL antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: KIRREL antibody was raised using a synthetic peptide corresponding to a region with amino acids FLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIRREL Blocking Peptide, catalog no. 33R-2959, is also available for use as a blocking control in assays to test for specificity of this KIRREL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIRREL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIRREL

Target: KIRREL (NEPH1) (Kin of IRRE Like 1 (NEPH1))

Alternative Name: KIRREL (NEPH1 Products)

Synonyms: NEPH1 antibody, 6720469N11Rik antibody, Kirrel1 antibody, Neph1 antibody, nephrin related antibody, kirre like nephrin family adhesion molecule 1 antibody, kin of IRRE like (Drosophila) antibody, Smp_104390 antibody, Smp_140170 antibody, KIRREL1 antibody, Kirrel antibody, Kirrel1 antibody

Background: KIRREL (NEPH1) is a member of the nephrin-like protein family, which includes NEPH2 and NEPH3. The cytoplasmic domains of these proteins interact with the C terminus of podocin (NPHS2), and the genes are expressed in kidney podocytes, cells involved in ensuring size- and charge-selective ultrafiltration.

Molecular Weight: 66 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization