DOLPP1 antibody (N-Term)

Catalog No. ABIN635468

Product Details anti-DOLPP1 Antibody

Target: DOLPP1 (Dolichyl Pyrophosphate Phosphatase 1 (DOLPP1))

Binding Specificity: N-Term

Reactivity: Mouse, Rat, Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DOLPP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DOLPP1 antibody was raised against the N terminal of DOLPP1

Purification: Affinity purified

Immunogen: DOLPP1 antibody was raised using the N terminal of DOLPP1 corresponding to a region with amino acids AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DOLPP1 Blocking Peptide, catalog no. 33R-1013, is also available for use as a blocking control in assays to test for specificity of this DOLPP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOLPP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DOLPP1

Target: DOLPP1 (Dolichyl Pyrophosphate Phosphatase 1 (DOLPP1))

Alternative Name: DOLPP1 (DOLPP1 Products)

Synonyms: zgc:101585 antibody, lsfr2 antibody, DOLPP1 antibody, 0610011H20Rik antibody, AB030189 antibody, LSFR2 antibody, dolichyldiphosphatase 1 antibody, dolichyl pyrophosphate phosphatase 1 antibody, dolichyldiphosphatase 1 L homeolog antibody, DOLPP1 antibody, dolpp1 antibody, Dolpp1 antibody, dolpp1.L antibody

Background: DOLPP1 is a multi-pass membrane proteinBy similarity. It belongs to the dolichyldiphosphatase family. It is required for efficient N-glycosylation and is necessary for maintaining optimal levels of dolichol-linked oligosaccharides. DOLPP1 hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. It does not act on phosphatidate.

Molecular Weight: 27 kDa (MW of target protein)