ORAI2 antibody (Middle Region)

Catalog No. ABIN635492

Product Details anti-ORAI2 Antibody

Target: ORAI2 (ORAI Calcium Release-Activated Calcium Modulator 2 (ORAI2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ORAI2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ORAI2 antibody was raised against the middle region of ORAI2

Purification: Affinity purified

Immunogen: ORAI2 antibody was raised using the middle region of ORAI2 corresponding to a region with amino acids IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ORAI2 Blocking Peptide, catalog no. 33R-3944, is also available for use as a blocking control in assays to test for specificity of this ORAI2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORAI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ORAI2

Target: ORAI2 (ORAI Calcium Release-Activated Calcium Modulator 2 (ORAI2))

Alternative Name: ORAI2 (ORAI2 Products)

Synonyms: C7orf19 antibody, CBCIP2 antibody, MEM142B antibody, TMEM142B antibody, A730041O15Rik antibody, Tmem142b antibody, RGD1310213 antibody, ORAI2 antibody, orai-1 antibody, orai1 antibody, tmem142a antibody, tmem142b antibody, LOC100230993 antibody, ORAI calcium release-activated calcium modulator 2 antibody, ORAI calcium release-activated calcium modulator 2 S homeolog antibody, ORAI2 antibody, Orai2 antibody, orai2.S antibody, orai2 antibody

Background: ORAI2 is a multi-pass membrane protein, and it belongs to the Orai family. It is a Ca(2+) release-activated Ca(2+)-like (CRAC-like) channel subunit which mediates Ca(2+) influx and increase in Ca(2+)-selective current by synergy with the Ca(2+) sensor, STIM1.

Molecular Weight: 28 kDa (MW of target protein)