TPST2 antibody (Middle Region)

Catalog No. ABIN635521

Product Details anti-TPST2 Antibody

Target: TPST2 (tyrosylprotein Sulfotransferase 2 (TPST2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPST2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TPST2 antibody was raised against the middle region of TPST2

Purification: Affinity purified

Immunogen: TPST2 antibody was raised using the middle region of TPST2 corresponding to a region with amino acids KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TPST2 Blocking Peptide, catalog no. 33R-4245, is also available for use as a blocking control in assays to test for specificity of this TPST2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPST2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPST2

Target: TPST2 (tyrosylprotein Sulfotransferase 2 (TPST2))

Alternative Name: TPST2 (TPST2 Products)

Synonyms: zgc:64196 antibody, AI448750 antibody, D5Ucla3 antibody, Tango13b antibody, grm antibody, grt antibody, TANGO13B antibody, tyrosylprotein sulfotransferase 2 antibody, tyrosylprotein sulfotransferase 2 L homeolog antibody, protein-tyrosine sulfotransferase 2 antibody, tpst2 antibody, TPST2 antibody, tpst2.L antibody, Tpst2 antibody

Background: TPST2 catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. TPST2 is a type II integral membrane protein found in the Golgi body.

Molecular Weight: 42 kDa (MW of target protein)