PRSS16 antibody

Catalog No. ABIN635540

Product Details anti-PRSS16 Antibody

Target: PRSS16 (Protease, serine, 16 (Thymus) (PRSS16))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRSS16 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRSS16 Blocking Peptide, catalog no. 33R-8518, is also available for use as a blocking control in assays to test for specificity of this PRSS16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRSS16

Target: PRSS16 (Protease, serine, 16 (Thymus) (PRSS16))

Alternative Name: PRSS16 (PRSS16 Products)

Synonyms: TSSP antibody, AI448615 antibody, protease, serine 16 antibody, protease, serine 16 S homeolog antibody, protease, serine 16 (thymus) antibody, PRSS16 antibody, prss16.S antibody, prss16 antibody, Prss16 antibody

Background: This gene encodes a serine protease expressed exclusively in the thymus. It is thought to play a role in the alternative antigen presenting pathway used by cortical thymic epithelial cells during the positive selection of T cells.

Molecular Weight: 55 kDa (MW of target protein)