CYP4V2 antibody (Middle Region)

Catalog No. ABIN635585

Product Details anti-CYP4V2 Antibody

Target: CYP4V2 (Cytochrome P450, Family 4, Subfamily V, Polypeptide 2 (CYP4V2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP4V2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP4 V2 antibody was raised against the middle region of CYP4 2

Purification: Affinity purified

Immunogen: CYP4 V2 antibody was raised using the middle region of CYP4 2 corresponding to a region with amino acids RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP4V2 Blocking Peptide, catalog no. 33R-8274, is also available for use as a blocking control in assays to test for specificity of this CYP4V2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP4V2

Target: CYP4V2 (Cytochrome P450, Family 4, Subfamily V, Polypeptide 2 (CYP4V2))

Alternative Name: CYP4V2 (CYP4V2 Products)

Synonyms: BCD antibody, CYP4AH1 antibody, CYP4V antibody, bcd antibody, cyp4ah1 antibody, MGC147146 antibody, cytochrome P450 family 4 subfamily V member 2 antibody, cytochrome P450 family 4 subfamily V member 2 S homeolog antibody, cytochrome P450, family 4, subfamily V, polypeptide 2 antibody, cytochrome P450, family 4, subfamily v, polypeptide 2 antibody, CYP4V2 antibody, cyp4v2.S antibody, cyp4v2 antibody

Background: This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy.

Molecular Weight: 61 kDa (MW of target protein)