SLC6A2 antibody
-
- Target See all SLC6A2 Antibodies
- SLC6A2 (Solute Carrier Family 6 (Neurotransmitter Transporter, Noradrenalin), Member 2 (SLC6A2))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC6A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC6 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF
- Top Product
- Discover our top product SLC6A2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC6A2 Blocking Peptide, catalog no. 33R-8875, is also available for use as a blocking control in assays to test for specificity of this SLC6A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC6A2 (Solute Carrier Family 6 (Neurotransmitter Transporter, Noradrenalin), Member 2 (SLC6A2))
- Alternative Name
- SLC6A2 (SLC6A2 Products)
- Synonyms
- NAT1 antibody, NET antibody, NET1 antibody, SLC6A5 antibody, NE-T antibody, Slc6a5 antibody, Net antibody, SLC6A2 antibody, solute carrier family 6 member 2 antibody, solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2 antibody, solute carrier family 6 member 5 antibody, SLC6A2 antibody, Slc6a2 antibody, SLC6A5 antibody
- Background
- The SLC6A2 gene encodes a norepinephrine (noradrenaline) transporter, which is responsible for reuptake of norepinephrine into presynaptic nerve terminals and is a regulator of norepinephrine homeostasis.
- Molecular Weight
- 69 kDa (MW of target protein)
-