P4HTM antibody (Middle Region)

Catalog No. ABIN635661

Product Details anti-P4HTM Antibody

Target: P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This P4HTM antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PH4 antibody was raised against the middle region of PH-4

Purification: Affinity purified

Immunogen: PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PH4 Blocking Peptide, catalog no. 33R-8025, is also available for use as a blocking control in assays to test for specificity of this PH4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PH-4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for P4HTM

Target: P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))

Alternative Name: PH4 (P4HTM Products)

Synonyms: Ph-4 antibody, RGD1311848 antibody, EGLN4 antibody, HIFPH4 antibody, P4H-TM antibody, PH-4 antibody, PH4 antibody, PHD4 antibody, 4933406E20Rik antibody, AI853847 antibody, BB128974 antibody, prolyl 4-hydroxylase, transmembrane antibody, prolyl 4-hydroxylase, transmembrane (endoplasmic reticulum) antibody, shisa family member 5 antibody, P4htm antibody, P4HTM antibody, SHISA5 antibody

Background: The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia.

Molecular Weight: 57 kDa (MW of target protein)