PTPRH antibody (Middle Region)

Catalog No. ABIN635715

Product Details anti-PTPRH Antibody

Target: PTPRH (Protein tyrosine Phosphatase, Receptor Type, H (PTPRH))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTPRH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PTPRH antibody was raised against the middle region of PTPRH

Purification: Affinity purified

Immunogen: PTPRH antibody was raised using the middle region of PTPRH corresponding to a region with amino acids QTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTPRH Blocking Peptide, catalog no. 33R-7755, is also available for use as a blocking control in assays to test for specificity of this PTPRH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPRH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTPRH

Target: PTPRH (Protein tyrosine Phosphatase, Receptor Type, H (PTPRH))

Alternative Name: PTPRH (PTPRH Products)

Synonyms: SAP-1 antibody, si:dkey-197c15.5 antibody, SAP1 antibody, sap-1 antibody, Bem2 antibody, protein tyrosine phosphatase, receptor type, h antibody, protein tyrosine phosphatase, receptor type H antibody, protein tyrosine phosphatase, receptor type, H antibody, ptprh antibody, PTPRH antibody, Ptprh antibody

Background: PTPRH is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracytoplasmic catalytic domain, and thus represents a receptor-type PTP. The extracellular region contains eight fibronectin type III-like repeats and multiple N-glycosylation sites. It was also found to be expressed in several cancer cell lines, but not in the corresponding normal tissues.

Molecular Weight: 120 kDa (MW of target protein)