XYLT2 antibody (Middle Region)

Catalog No. ABIN635743

Product Details anti-XYLT2 Antibody

Target: XYLT2 (Xylosyltransferase II (XYLT2))

Binding Specificity: Middle Region

Reactivity: Mouse, Human, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XYLT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: XYLT2 antibody was raised against the middle region of XYLT2

Purification: Affinity purified

Immunogen: XYLT2 antibody was raised using the middle region of XYLT2 corresponding to a region with amino acids PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XYLT2 Blocking Peptide, catalog no. 33R-7222, is also available for use as a blocking control in assays to test for specificity of this XYLT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XYLT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for XYLT2

Target: XYLT2 (Xylosyltransferase II (XYLT2))

Alternative Name: XYLT2 (XYLT2 Products)

Synonyms: MGC89331 antibody, PXYLT2 antibody, XT-II antibody, XT2 antibody, xylT-II antibody, xt-II antibody, E030002B02Rik antibody, xylt-II antibody, xylosyltransferase II antibody, xylosyltransferase 2 antibody, xylt2 antibody, XYLT2 antibody, Xylt2 antibody

Background: XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases.

Molecular Weight: 97 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process