Tetraspanin 5 antibody (Middle Region)
-
- Target See all Tetraspanin 5 (TSPAN5) Antibodies
- Tetraspanin 5 (TSPAN5)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Tetraspanin 5 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- Tetraspanin 5 antibody was raised against the middle region of TSPAN5
- Purification
- Affinity purified
- Immunogen
- Tetraspanin 5 antibody was raised using the middle region of TSPAN5 corresponding to a region with amino acids ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ
- Top Product
- Discover our top product TSPAN5 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Tetraspanin 5 Blocking Peptide, catalog no. 33R-1526, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Tetraspanin 5 (TSPAN5)
- Alternative Name
- Tetraspanin 5 (TSPAN5 Products)
- Background
- TSPAN5 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
- Molecular Weight
- 30 kDa (MW of target protein)
-