TSPAN12 antibody (Middle Region)

Catalog No. ABIN635761

Product Details anti-TSPAN12 Antibody

Target: TSPAN12 (Tetraspanin 12 (TSPAN12))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSPAN12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Tetraspanin 12 antibody was raised against the middle region of TSPAN12

Purification: Affinity purified

Immunogen: Tetraspanin 12 antibody was raised using the middle region of TSPAN12 corresponding to a region with amino acids EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 12 Blocking Peptide, catalog no. 33R-2410, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSPAN12

Target: TSPAN12 (Tetraspanin 12 (TSPAN12))

Alternative Name: Tetraspanin 12 (TSPAN12 Products)

Synonyms: tm4sf12 antibody, zgc:63880 antibody, EVR5 antibody, NET-2 antibody, NET2 antibody, TM4SF12 antibody, 9030619E17 antibody, AI426782 antibody, AI663988 antibody, AW111457 antibody, Tm4sf12 antibody, tetraspanin-7 antibody, tetraspanin 12 antibody, LOC412465 antibody, TSPAN12 antibody, tspan12 antibody, Tspan12 antibody

Background: TSPAN12 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Molecular Weight: 35 kDa (MW of target protein)