Tetraspanin 15 antibody (C-Term)

Catalog No. ABIN635763

Product Details anti-Tetraspanin 15 Antibody

Target: Tetraspanin 15 (TSPAN15)

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tetraspanin 15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Tetraspanin 15 antibody was raised against the C terminal of TSPAN15

Purification: Affinity purified

Immunogen: Tetraspanin 15 antibody was raised using the C terminal of TSPAN15 corresponding to a region with amino acids LGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 15 Blocking Peptide, catalog no. 33R-4975, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tetraspanin 15

Target: Tetraspanin 15 (TSPAN15)

Alternative Name: Tetraspanin 15 (TSPAN15 Products)

Synonyms: MGC82964 antibody, zgc:110375 antibody, 2700063A19Rik antibody, NET-7 antibody, NET7 antibody, TM4SF15 antibody, 1110036D12Rik antibody, AW048364 antibody, Tm4sf15 antibody, tetraspanin 15 antibody, tetraspanin 15 L homeolog antibody, TSPAN15 antibody, tspan15.L antibody, tspan15 antibody, Tspan15 antibody

Background: TSPAN15 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene.

Molecular Weight: 33 kDa (MW of target protein)