UQCR10 antibody
-
- Target See all UQCR10 Antibodies
- UQCR10 (Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UQCR10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- UCRC antibody was raised using a synthetic peptide corresponding to a region with amino acids LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
- Top Product
- Discover our top product UQCR10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UCRC Blocking Peptide, catalog no. 33R-4946, is also available for use as a blocking control in assays to test for specificity of this UCRC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCRC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UQCR10 (Ubiquinol-Cytochrome C Reductase, Complex III Subunit X (UQCR10))
- Alternative Name
- UCRC (UQCR10 Products)
- Synonyms
- Ucrc antibody, UCRC antibody, qcr9 antibody, ucrc antibody, HSPC051 antibody, HSPC151 antibody, QCR9 antibody, UCCR7.2 antibody, 1110020P15Rik antibody, AA960494 antibody, ubiquinol-cytochrome c reductase, complex III subunit X antibody, ubiquinol-cytochrome c reductase complex 7.2 kDa protein antibody, ubiquinol-cytochrome c reductase, complex III subunit X L homeolog antibody, Uqcr10 antibody, UQCR10 antibody, uqcr10.L antibody
- Background
- UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase, EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane.
- Molecular Weight
- 7 kDa (MW of target protein)
-