BTN2A1 antibody (N-Term)

Catalog No. ABIN635811

Product Details anti-BTN2A1 Antibody

Target: BTN2A1 (butyrophilin, Subfamily 2, Member A1 (BTN2A1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BTN2A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BTN2 A1 antibody was raised against the N terminal of BTN2 1

Purification: Affinity purified

Immunogen: BTN2 A1 antibody was raised using the N terminal of BTN2 1 corresponding to a region with amino acids SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BTN2A1 Blocking Peptide, catalog no. 33R-8900, is also available for use as a blocking control in assays to test for specificity of this BTN2A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTN0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BTN2A1

Target: BTN2A1 (butyrophilin, Subfamily 2, Member A1 (BTN2A1))

Alternative Name: BTN2A1 (BTN2A1 Products)

Synonyms: BK14H9.1 antibody, BT2.1 antibody, BTF1 antibody, DJ3E1.1 antibody, BTN2A1 antibody, btf1 antibody, bt2.1 antibody, BTN2A2 antibody, butyrophilin subfamily 2 member A1 antibody, butyrophilin subfamily 2 member A1 S homeolog antibody, butyrophilin, subfamily 2, member A1 antibody, BTN2A1 antibody, btn2a1.S antibody, btn2a1 antibody, LOC100409586 antibody

Background: This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin geneuperfamily. The encoded protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Activated T Cell Proliferation