CYP3A4 antibody (C-Term)

Catalog No. ABIN635831

Product Details anti-CYP3A4 Antibody

Target: CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP3A4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP3 A43 antibody was raised against the C terminal of CYP3 43

Purification: Affinity purified

Immunogen: CYP3 A43 antibody was raised using the C terminal of CYP3 43 corresponding to a region with amino acids IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP3A43 Blocking Peptide, catalog no. 33R-4217, is also available for use as a blocking control in assays to test for specificity of this CYP3A43 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 43 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP3A4

Target: CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))

Alternative Name: CYP3A43 (CYP3A4 Products)

Synonyms: CP33 antibody, CP34 antibody, CYP3A antibody, CYP3A3 antibody, CYPIIIA3 antibody, CYPIIIA4 antibody, HLP antibody, NF-25 antibody, P450C3 antibody, P450PCN1 antibody, MGC108372 antibody, CYP3A80 antibody, CYP3A4 antibody, CYP3A21 antibody, CYPIIIA21 antibody, CYP3A12 antibody, cytochrome P450 family 3 subfamily A member 4 antibody, cytochrome P450 family 3 subfamily A member 43 antibody, cytochrome P450 3A4 antibody, cytochrome P450, subfamily IIIA, polypeptide 4 antibody, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4 antibody, cytochrome P450, family 3, subfamily A, polypeptide 4 antibody, CYP3A4 antibody, CYP3A43 antibody, PTRG_01782 antibody, PTRG_06060 antibody, cyp3a4 antibody

Background: CYP3A43 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis