TMEM158 antibody (Middle Region)

Catalog No. ABIN635848

Product Details anti-TMEM158 Antibody

Target: TMEM158 (Transmembrane Protein 158 (TMEM158))

Binding Specificity: Middle Region

Reactivity: Mouse, Rat, Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM158 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM158 antibody was raised against the middle region of TMEM158

Purification: Affinity purified

Immunogen: TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM158 Blocking Peptide, catalog no. 33R-1244, is also available for use as a blocking control in assays to test for specificity of this TMEM158 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM158 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM158

Target: TMEM158 (Transmembrane Protein 158 (TMEM158))

Alternative Name: TMEM158 (TMEM158 Products)

Synonyms: 2310037P21Rik antibody, Ris1 antibody, BBP antibody, RIS1 antibody, p40BBP antibody, transmembrane protein 158 antibody, transmembrane protein 158 (gene/pseudogene) antibody, Tmem158 antibody, TMEM158 antibody

Background: TMEM158 is the receptor for brain injury-derived neurotrophic peptide (BINP), a synthetic 13-mer peptide.

Molecular Weight: 30 kDa (MW of target protein)