SLC24A6 antibody (Middle Region)
-
- Target See all SLC24A6 Antibodies
- SLC24A6 (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 6 (SLC24A6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC24A6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC24 A6 antibody was raised against the middle region of SLC24 6
- Purification
- Affinity purified
- Immunogen
- SLC24 A6 antibody was raised using the middle region of SLC24 6 corresponding to a region with amino acids SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTE
- Top Product
- Discover our top product SLC24A6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC24A6 Blocking Peptide, catalog no. 33R-8526, is also available for use as a blocking control in assays to test for specificity of this SLC24A6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC24A6 (Solute Carrier Family 24 (Sodium/potassium/calcium Exchanger), Member 6 (SLC24A6))
- Alternative Name
- SLC24A6 (SLC24A6 Products)
- Synonyms
- slc24a6 antibody, NCKX6 antibody, NCLX antibody, SLC24A6 antibody, AF261233 antibody, Slc24a6 antibody, solute carrier family 8 member B1 antibody, solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 antibody, solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 S homeolog antibody, SLC8B1 antibody, slc8b1 antibody, Slc8b1 antibody, slc8b1.S antibody
- Background
- SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion.
- Molecular Weight
- 64 kDa (MW of target protein)
- Pathways
- Carbohydrate Homeostasis
-