CLPTM1L antibody (Middle Region)

Catalog No. ABIN635900

Product Details anti-CLPTM1L Antibody

Target: CLPTM1L (CLPTM1-Like (CLPTM1L))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLPTM1L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CLPTM1 L antibody was raised against the middle region of CLPTM1

Purification: Affinity purified

Immunogen: CLPTM1 L antibody was raised using the middle region of CLPTM1 corresponding to a region with amino acids KAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLPTM1L Blocking Peptide, catalog no. 33R-4238, is also available for use as a blocking control in assays to test for specificity of this CLPTM1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLPTM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLPTM1L

Target: CLPTM1L (CLPTM1-Like (CLPTM1L))

Alternative Name: CLPTM1L (CLPTM1L Products)

Synonyms: CRR9 antibody, C130052I12Rik antibody, Crr9 antibody, RGD1307896 antibody, C130052I12RIK antibody, CLPTM1 like antibody, CLPTM1-like antibody, cleft lip and palate transmembrane protein 1-like protein antibody, CLPTM1L antibody, clptm1l antibody, LOC100338302 antibody, Clptm1l antibody

Background: CLPTM1L enhances cisplatin-mediated apoptosis, when overexpressed.

Molecular Weight: 62 kDa (MW of target protein)