SLC39A12 antibody
-
- Target See all SLC39A12 Antibodies
- SLC39A12 (Solute Carrier Family 39 (Zinc Transporter), Member 12 (SLC39A12))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC39A12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC39 A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL
- Top Product
- Discover our top product SLC39A12 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC39A12 Blocking Peptide, catalog no. 33R-5811, is also available for use as a blocking control in assays to test for specificity of this SLC39A12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC39A12 (Solute Carrier Family 39 (Zinc Transporter), Member 12 (SLC39A12))
- Alternative Name
- SLC39A12 (SLC39A12 Products)
- Synonyms
- LZT-Hs8 antibody, ZIP-12 antibody, bA570F3.1 antibody, AW046938 antibody, Gm731 antibody, solute carrier family 39 member 12 antibody, solute carrier family 39 (zinc transporter), member 12 antibody, SLC39A12 antibody, Slc39a12 antibody, slc39a12 antibody
- Background
- SLC39A12 may act as a zinc-influx transporter and also may be partly involved in the outbreak of schizophrenia.
- Molecular Weight
- 73 kDa (MW of target protein)
-