TMEM187 antibody (Middle Region)

Catalog No. ABIN635956

Product Details anti-TMEM187 Antibody

Target: TMEM187 (Transmembrane Protein 187 (TMEM187))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM187 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM187 antibody was raised against the middle region of TMEM187

Purification: Affinity purified

Immunogen: TMEM187 antibody was raised using the middle region of TMEM187 corresponding to a region with amino acids ECVSLASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM187 Blocking Peptide, catalog no. 33R-2300, is also available for use as a blocking control in assays to test for specificity of this TMEM187 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM187 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM187

Target: TMEM187 (Transmembrane Protein 187 (TMEM187))

Alternative Name: TMEM187 (TMEM187 Products)

Synonyms: si:dkey-9i23.7 antibody, TMEM187 antibody, CXorf12 antibody, DXS9878E antibody, ITBA1 antibody, transmembrane protein 187 antibody, Transmembrane protein 187 antibody, LOC465934 antibody, TMEM187 antibody, tmem187 antibody, tm187 antibody

Background: TMEM187 is a multi-pass membrane protein. The exact function of TMEM187 remains unknown.

Molecular Weight: 29 kDa (MW of target protein)