DHRS7B antibody
-
- Target See all DHRS7B Antibodies
- DHRS7B (Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DHRS7B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DHRS7 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA
- Top Product
- Discover our top product DHRS7B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DHRS7B Blocking Peptide, catalog no. 33R-7459, is also available for use as a blocking control in assays to test for specificity of this DHRS7B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHRS0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHRS7B (Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B))
- Alternative Name
- DHRS7B (DHRS7B Products)
- Synonyms
- MGC146711 antibody, SDR32C1 antibody, BC003479 antibody, C79874 antibody, C80074 antibody, PexRAP antibody, RGD1311243 antibody, zgc:112518 antibody, dehydrogenase/reductase 7B antibody, dehydrogenase/reductase (SDR family) member 7B antibody, dehydrogenase/reductase (SDR family) member 7B L homeolog antibody, DHRS7B antibody, dhrs7b antibody, Dhrs7b antibody, dhrs7b.L antibody
- Background
- This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.
- Molecular Weight
- 35 kDa (MW of target protein)
-