TMCO3 antibody (N-Term)

Catalog No. ABIN635995

Product Details anti-TMCO3 Antibody

Target: TMCO3 (Transmembrane and Coiled-Coil Domains 3 (TMCO3))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMCO3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMCO3 antibody was raised against the N terminal of TMCO3

Purification: Affinity purified

Immunogen: TMCO3 antibody was raised using the N terminal of TMCO3 corresponding to a region with amino acids KTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMCO3 Blocking Peptide, catalog no. 33R-4672, is also available for use as a blocking control in assays to test for specificity of this TMCO3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCO3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMCO3

Target: TMCO3 (Transmembrane and Coiled-Coil Domains 3 (TMCO3))

Alternative Name: TMCO3 (TMCO3 Products)

Synonyms: C13orf11 antibody, B230339H12Rik antibody, C87304 antibody, RGD1306586 antibody, transmembrane and coiled-coil domains 3 antibody, TMCO3 antibody, Tmco3 antibody, tmco3 antibody

Background: TMCO3 belongs to the monovalent cation:proton antiporter 2 (CPA2) transporter family. It is a multi-pass membrane protein. TMCO3 is a probable Na(+)/H(+) antiporter.

Molecular Weight: 75 kDa (MW of target protein)

Pathways: Proton Transport