GALNT14 antibody
-
- Target See all GALNT14 Antibodies
- GALNT14 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 14 (GalNAc-T14) (GALNT14))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GALNT14 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GALNT14 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAEVWMDEYKQYYYA
- Top Product
- Discover our top product GALNT14 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GALNT14 Blocking Peptide, catalog no. 33R-4908, is also available for use as a blocking control in assays to test for specificity of this GALNT14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GALNT14 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 14 (GalNAc-T14) (GALNT14))
- Alternative Name
- GALNT14 (GALNT14 Products)
- Synonyms
- 0610033M06Rik antibody, si:ch211-147c1.1 antibody, GALNT15 antibody, GalNac-T10 antibody, GalNac-T14 antibody, polypeptide N-acetylgalactosaminyltransferase 14 antibody, UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 14 (GalNAc-T14) antibody, GALNT14 antibody, galnt14 antibody, Galnt14 antibody
- Background
- GALNT14 (EC 2.4.1.41) belongs to a large subfamily of glycosyltransferases residing in the Golgi apparatus. GALNT enzymes catalyze the first step in the O-glycosylation of mammalian proteins by transferring N-acetyl-D-galactosamine (GalNAc) to peptide substrates.
- Molecular Weight
- 64 kDa (MW of target protein)
-