ST6GALNAC2 antibody (Middle Region)
-
- Target See all ST6GALNAC2 Antibodies
- ST6GALNAC2 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 2 (ST6GALNAC2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ST6GALNAC2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ST6 GALNAC2 antibody was raised against the middle region of ST6 ALNAC2
- Purification
- Affinity purified
- Immunogen
- ST6 GALNAC2 antibody was raised using the middle region of ST6 ALNAC2 corresponding to a region with amino acids VNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVP
- Top Product
- Discover our top product ST6GALNAC2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ST6GALNAC2 Blocking Peptide, catalog no. 33R-9714, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ST6GALNAC2 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 2 (ST6GALNAC2))
- Alternative Name
- ST6GALNAC2 (ST6GALNAC2 Products)
- Synonyms
- SAITL1 antibody, SIAT7 antibody, SIAT7B antibody, SIATL1 antibody, ST6GalNAII antibody, STHM antibody, II antibody, ST6GalNAc antibody, Siat7 antibody, Siat7b antibody, ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 antibody, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 antibody, ST6GALNAC2 antibody, St6galnac2 antibody
- Background
- ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting.
- Molecular Weight
- 42 kDa (MW of target protein)
-