GDE1 antibody (N-Term)

Catalog No. ABIN636050

Product Details anti-GDE1 Antibody

Target: GDE1 (Glycerophosphodiester Phosphodiesterase 1 (GDE1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GDE1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: GDE1 antibody was raised against the N terminal Of Gde1

Purification: Affinity purified

Immunogen: GDE1 antibody was raised using the N terminal Of Gde1 corresponding to a region with amino acids LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GDE1 Blocking Peptide, catalog no. 33R-5401, is also available for use as a blocking control in assays to test for specificity of this GDE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GDE1

Target: GDE1 (Glycerophosphodiester Phosphodiesterase 1 (GDE1))

Alternative Name: GDE1 (GDE1 Products)

Synonyms: zgc:56068 antibody, zgc:77135 antibody, 363E6.2 antibody, MIR16 antibody, 1200003M13Rik antibody, Mir16 antibody, RGS16 antibody, glycerophosphodiester phosphodiesterase 1 antibody, glycerophosphodiester phosphodiesterase 1 L homeolog antibody, gde1 antibody, gde1.L antibody, GDE1 antibody, Gde1 antibody

Background: GDE1 has glycerophosphoinositol phosphodiesterase activity. It has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways.

Molecular Weight: 38 kDa (MW of target protein)