Arylsulfatase E antibody

Catalog No. ABIN636061

Product Details anti-Arylsulfatase E Antibody

Target: Arylsulfatase E (ARSE)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Arylsulfatase E antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ARSE antibody was raised using a synthetic peptide corresponding to a region with amino acids KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQAVWEHQRTLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARSE Blocking Peptide, catalog no. 33R-4727, is also available for use as a blocking control in assays to test for specificity of this ARSE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Arylsulfatase E

Target: Arylsulfatase E (ARSE)

Alternative Name: ARSE (ARSE Products)

Synonyms: ASE antibody, CDPX antibody, CDPX1 antibody, CDPXR antibody, ARSE antibody, MGC155058 antibody, arylsulfatase E (chondrodysplasia punctata 1) antibody, arylsulfatase E antibody, ARSE antibody, Arse antibody

Background: Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.

Molecular Weight: 62 kDa (MW of target protein)