TMPRSS12 antibody (Middle Region)
-
- Target See all TMPRSS12 products
- TMPRSS12 (Transmembrane (C-terminal) Protease, serine 12 (TMPRSS12))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMPRSS12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMPRSS12 antibody was raised against the middle region of TMPRSS12
- Purification
- Affinity purified
- Immunogen
- TMPRSS12 antibody was raised using the middle region of TMPRSS12 corresponding to a region with amino acids KEEGNATNILQDAEVHYISREMCNSERSYGGIIPNTSFCAGDEDGAFDTC
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMPRSS12 Blocking Peptide, catalog no. 33R-4324, is also available for use as a blocking control in assays to test for specificity of this TMPRSS12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMPRSS12 (Transmembrane (C-terminal) Protease, serine 12 (TMPRSS12))
- Alternative Name
- TMPRSS12 (TMPRSS12 Products)
- Synonyms
- 4930478A21Rik antibody, transmembrane protease, serine 12 antibody, transmembrane (C-terminal) protease, serine 12 antibody, TMPRSS12 antibody, tmprss12 antibody, Tmprss12 antibody
- Background
- TMPRSS12 belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme.
- Molecular Weight
- 38 kDa (MW of target protein)
-