TMPRSS12 antibody (Middle Region)

Catalog No. ABIN636063

Product Details anti-TMPRSS12 Antibody

Target: TMPRSS12 (Transmembrane (C-terminal) Protease, serine 12 (TMPRSS12))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMPRSS12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMPRSS12 antibody was raised against the middle region of TMPRSS12

Purification: Affinity purified

Immunogen: TMPRSS12 antibody was raised using the middle region of TMPRSS12 corresponding to a region with amino acids KEEGNATNILQDAEVHYISREMCNSERSYGGIIPNTSFCAGDEDGAFDTC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMPRSS12 Blocking Peptide, catalog no. 33R-4324, is also available for use as a blocking control in assays to test for specificity of this TMPRSS12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMPRSS12

Target: TMPRSS12 (Transmembrane (C-terminal) Protease, serine 12 (TMPRSS12))

Alternative Name: TMPRSS12 (TMPRSS12 Products)

Synonyms: 4930478A21Rik antibody, transmembrane protease, serine 12 antibody, transmembrane (C-terminal) protease, serine 12 antibody, TMPRSS12 antibody, tmprss12 antibody, Tmprss12 antibody

Background: TMPRSS12 belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme.

Molecular Weight: 38 kDa (MW of target protein)