SLC27A5 antibody

Catalog No. ABIN636073

Product Details anti-SLC27A5 Antibody

Target: SLC27A5 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC27A5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC27 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC27A5 Blocking Peptide, catalog no. 33R-4549, is also available for use as a blocking control in assays to test for specificity of this SLC27A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC27A5

Target: SLC27A5 (Solute Carrier Family 27 (Fatty Acid Transporter), Member 5 (SLC27A5))

Alternative Name: SLC27A5 (SLC27A5 Products)

Synonyms: ACSB antibody, ACSVL6 antibody, BACS antibody, BAL antibody, FACVL3 antibody, FATP-5 antibody, FATP5 antibody, VLACSR antibody, VLCS-H2 antibody, VLCSH2 antibody, Vlacsr antibody, rBAL-1 antibody, SLC27A5 antibody, solute carrier family 27 member 5 antibody, solute carrier family 27 (fatty acid transporter), member 5 antibody, bile acyl-CoA synthetase antibody, SLC27A5 antibody, Slc27a5 antibody, LOC608675 antibody, LOC100450572 antibody

Background: The protein encoded by this gene is an isozyme of very long-chain acyl-CoA synthetase (VLCS). It is capable of activating very long-chain fatty-acids containing 24- and 26-carbons.

Molecular Weight: 75 kDa (MW of target protein)