Parathyroid Hormone 2 (PTH2) (Middle Region) antibody

Catalog No. ABIN636078

Product Details

Target: Parathyroid Hormone 2 (PTH2)

Binding Specificity: Middle Region

Reactivity: Hormone

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: PTH2 antibody was raised against the middle region of PTH2

Purification: Affinity purified

Immunogen: PTH2 antibody was raised using the middle region of PTH2 corresponding to a region with amino acids WADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTH2 Blocking Peptide, catalog no. 33R-9931, is also available for use as a blocking control in assays to test for specificity of this PTH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Parathyroid Hormone 2 (PTH2)

Alternative Name: PTH2 (PTH2 Products)

Synonyms: TIP39 antibody, Tifp39 antibody, Tip39 antibody, RGD1559447 antibody, pth2 antibody, parathyroid hormone 2 antibody, parathyroid hormone 1b antibody, tuberoinfundibular 39 residue protein antibody, PTH2 antibody, Pth2 antibody, pth1b antibody, TIP39 antibody

Target Type: Hormone

Background: TIP39 is related to parathyroid hormone (PTH) and PTH-related protein (PTHRP) and is a ligand for PTH receptor-2.

Molecular Weight: 11 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, cAMP Metabolic Process, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development