CYB561 antibody (Middle Region)

Catalog No. ABIN636106

Product Details anti-CYB561 Antibody

Target: CYB561 (Cytochrome B-561 (CYB561))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYB561 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYB561 antibody was raised against the middle region of CYB561

Purification: Affinity purified

Immunogen: CYB561 antibody was raised using the middle region of CYB561 corresponding to a region with amino acids LFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYB561 Blocking Peptide, catalog no. 33R-4943, is also available for use as a blocking control in assays to test for specificity of this CYB561 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYB561 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYB561

Target: CYB561 (Cytochrome B-561 (CYB561))

Alternative Name: CYB561 (CYB561 Products)

Synonyms: CYB561A1 antibody, FRRS2 antibody, ECK1410 antibody, JW5224 antibody, MGC69260 antibody, zgc:193680 antibody, zgc:193701 antibody, ACYB-1 antibody, MBB18.18 antibody, MBB18_18 antibody, cytochrome B561-1 antibody, xcyt antibody, cytochrome b561 antibody, cytochrome b-561 antibody, cytochrome B561-1 antibody, cytochrome b561 L homeolog antibody, CYB561 antibody, cytb561 antibody, cybB antibody, LOC5576849 antibody, LOC5576850 antibody, Cyb561 antibody, cyb561 antibody, CYB-1 antibody, cyb561.L antibody, LOC100347599 antibody

Background: CYB561 is a senescene-associated protein in normal human oral keratinocytes.

Molecular Weight: 27 kDa (MW of target protein)