C12orf53 antibody (Middle Region)

Catalog No. ABIN636113

Product Details anti-C12orf53 Antibody

Target: C12orf53 (Chromosome 12 Open Reading Frame 53 (C12orf53))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C12orf53 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C12 ORF53 antibody was raised against the middle region of C12 rf53

Purification: Affinity purified

Immunogen: C12 ORF53 antibody was raised using the middle region of C12 rf53 corresponding to a region with amino acids VWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C12ORF53 Blocking Peptide, catalog no. 33R-9910, is also available for use as a blocking control in assays to test for specificity of this C12ORF53 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF53 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C12orf53

Target: C12orf53 (Chromosome 12 Open Reading Frame 53 (C12orf53))

Alternative Name: C12ORF53 (C12orf53 Products)

Background: The function of Chromosome 12 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 30 kDa (MW of target protein)