EDAR antibody (Middle Region)

Catalog No. ABIN636121

Product Details anti-EDAR Antibody

Target: EDAR (Ectodysplasin A Receptor (EDAR))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EDAR antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Ectodysplasin A Receptor antibody was raised against the middle region of EDAR

Purification: Affinity purified

Immunogen: Ectodysplasin A Receptor antibody was raised using the middle region of EDAR corresponding to a region with amino acids PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Ectodysplasin A Receptor Blocking Peptide, catalog no. 33R-6971, is also available for use as a blocking control in assays to test for specificity of this Ectodysplasin A Receptor antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EDAR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EDAR

Target: EDAR (Ectodysplasin A Receptor (EDAR))

Alternative Name: Ectodysplasin A Receptor (EDAR Products)

Synonyms: rs3 antibody, edar antibody, EDAR antibody, MGC88893 antibody, DL antibody, ECTD10A antibody, ECTD10B antibody, ED1R antibody, ED3 antibody, ED5 antibody, EDA-A1R antibody, EDA1R antibody, EDA3 antibody, HRM1 antibody, dl antibody, RGD1561714 antibody, ectodysplasin A receptor antibody, ectodysplasin-A receptor antibody, edar antibody, EDAR antibody, Edar antibody

Background: EDAR is a member of the tumor necrosis factor receptor family. It is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in the gene encoding EDAR result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Tube Formation, Ubiquitin Proteasome Pathway