Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN971363

Programmed Cell Death 4 (Neoplastic Transformation Inhibitor) (PDCD4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms H731, Ma3, Tis, D19Ucla1, Dug, h731, MGC69337, PDCD4
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN971363
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PDCD4 antibody: synthetic peptide directed towards the N terminal of human PDCD4
Sequence MTKYPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSIN EARINAKAKR
Predicted Reactivity Bovine : 100%, Dog : 100%, Goat : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against PDCD4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PDCD4
Background PDCD4 is a protein localized to the nucleus in proliferating cells. Expression of its gene is modulated by cytokines in natural killer and T cells. PDCD4 is thought to play a role in apoptosis but the specific role has not yet been determined.This gene encodes a protein localized to the nucleus in proliferating cells. Expression of this gene is modulated by cytokines in natural killer and T cells. The gene product is thought to play a role in apoptosis but the specific role has not yet been determined. Two transcripts encoding different isoforms have been identified.
Molecular Weight 50kDa
Gene ID 27250
NCBI Accession NP_663314, NM_145341
UniProt Q53EL6
Research Area Cancer, Apoptosis/Necrosis, Transcription Factors, Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PDCD4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Yang, Cho, Zakowicz et al.: "A novel function of the MA-3 domains in transformation and translation suppressor Pdcd4 is essential for its binding to eukaryotic translation initiation factor 4A." in: Molecular and cellular biology, Vol. 24, Issue 9, pp. 3894-906, 2004 (PubMed).

Alternatives for antigen "Programmed Cell Death 4 (Neoplastic Transformation Inhibitor) (PDCD4)", type "Antibodies"
Hosts (96), (20), (4)
Reactivities (125), (75), (74), (13), (6), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (106), (76), (39), (35), (11), (10), (10), (5), (4), (3), (2), (2)
Conjugates (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (20), (20), (9), (8), (6), (6), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon