Programmed Cell Death 4 (Neoplastic Transformation Inhibitor) (PDCD4) (N-Term) antibody

Details for Product No. ABIN971363
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms H731, Ma3, Tis, D19Ucla1, Dug, h731, MGC69337, PDCD4
Epitope
N-Term
(24), (23), (10), (10), (10), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(136), (84), (84), (11), (6), (2), (2), (2), (1)
Host
Rabbit
(108), (22), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(117), (80), (46), (34), (12), (10), (6), (5), (3), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN971363
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PDCD4
Sequence MTKYPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSIN EARINAKAKR
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Goat : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against PDCD4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PDCD4
Background PDCD4 is a protein localized to the nucleus in proliferating cells. Expression of its gene is modulated by cytokines in natural killer and T cells. PDCD4 is thought to play a role in apoptosis but the specific role has not yet been determined.This gene encodes a protein localized to the nucleus in proliferating cells. Expression of this gene is modulated by cytokines in natural killer and T cells. The gene product is thought to play a role in apoptosis but the specific role has not yet been determined. Two transcripts encoding different isoforms have been identified.
Molecular Weight 50 kDa
Gene ID 27250
NCBI Accession NM_145341, NP_663314
UniProt Q53EL6
Research Area Cancer, Apoptosis/Necrosis, Transcription Factors, Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 458 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Programmed Cell Death 4 (Neoplastic Transformation Inhibitor) (PDCD4) (N-Term) antibody WB Suggested Anti-PDCD4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Yang, Cho, Zakowicz et al.: "A novel function of the MA-3 domains in transformation and translation suppressor Pdcd4 is essential for its binding to eukaryotic translation initiation factor 4A." in: Molecular and cellular biology, Vol. 24, Issue 9, pp. 3894-906, 2004 (PubMed).

Hosts (108), (22), (4)
Reactivities (136), (84), (84), (11), (6), (2), (2), (2), (1)
Applications (117), (80), (46), (34), (12), (10), (6), (5), (3), (3), (2)
Conjugates (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (24), (23), (10), (10), (10), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
back to top