Product details for 15 kDa selenoprotein (15-Sep) (Human) antibody
15 kDa selenoprotein (15-Sep) (Human) antibody
Overview
|
|
| Antigen: | 15 kDa selenoprotein (15-Sep) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN171749 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: 15 kDa selenoprotein (15-Sep) (Human) antibody
| Antigen | 15 kDa selenoprotein (15-Sep) |
| Gene ID | 9403 |
| Immunogen | SEP15 (NP_004252, 97 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) KLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNT DSVEEFLSEKLERI* |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | 15 kDa selenoprotein This gene encodes one of the selenoproteins containing selenocysteine at the active site. The selenocysteine is encoded by the nonsense (stop) codon UGA. Studies in mouse suggest that this selenoprotein may have redox function. This gene is localized on chromosome 1p31, a genetic locus commonly mutated or deleted in human cancers. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. Mouse polyclonal antibody raised against a partial recombinant SEP15. |
| Host | Mouse |
Application Details: 15 kDa selenoprotein (15-Sep) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (33.70 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: 15 kDa selenoprotein (15-Sep) (Human) antibody
|
Western Blot detection against Immunogen (33.70 KDa) . |
External Information: 15 kDa selenoprotein (15-Sep) (Human) antibody
| Google Scholar | Find more references for antigen 15-Sep on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen 15-Sep (Bioinformatic Harvester (EMBL)) |








