Product details for  1-acylglycerol-3-phosphate O-acyltransferase 3 (AGPAT3) (...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

1-acylglycerol-3-phosphate O-acyltransferase 3 (AGPAT3) (Human) antibody

Overview

Image for 1-acylglycerol-3-phosphate O-acyltransferase 3 (AGPAT3) (Human) antibody
Antigen: 1-acylglycerol-3-phosphate O-acyltransferase 3 (AGPAT3)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN172753
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  1-acylglycerol-3-phosphate O-acyltransferase 3 (AGPAT3) (Human) antibody

back to top ^


Antigen 1-acylglycerol-3-phosphate O-acyltransferase 3 (AGPAT3)
Gene ID 56894
Immunogen AGPAT3 (NP_064517, 155 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) VVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTK GFTTAVKCLRGTVAAVYDVTLNFRGNKNPSLLGILYGKKYEADMCVRRFP*
Reactivity Human
Antibody Type Polyclonal
Description 1-acylglycerol-3-phosphate O-acyltransferase 3 The protein encoded by this gene is an acyltransferase that converts lysophosphatidic acid into phosphatidic acid, which is the second step in the de novo phospholipid biosynthetic pathway. The encoded protein may be an integral membrane protein. Two transcript variants encoding the same protein have been found for this gene. Mouse polyclonal antibody raised against a partial recombinant AGPAT3. Synonyms: LPAAT-GAMMA1, MGC4604
Host Mouse

Application Details:  1-acylglycerol-3-phosphate O-acyltransferase 3 (AGPAT3) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.66 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  1-acylglycerol-3-phosphate O-acyltransferase 3 (AGPAT3) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.66 KDa) .

Image for 1-acylglycerol-3-phosphate O-acyltransferase 3 (AGPAT3) (Human) antibody (1)

External Information:  1-acylglycerol-3-phosphate O-acyltransferase 3 (AGPAT3) (Human) antibody

back to top ^


Google Scholar Find more references for antigen AGPAT3 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen AGPAT3 (Bioinformatic Harvester (EMBL))