Product details for 1-aminocyclopropane-1-carboxylate synthase (PHACS) (Human...
1-aminocyclopropane-1-carboxylate synthase (PHACS) (Human) antibody
Overview
|
|
| Antigen: | 1-aminocyclopropane-1-carboxylate synthase (PHACS) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN169463 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: 1-aminocyclopropane-1-carboxylate synthase (PHACS) (Human) antibody
| Antigen | 1-aminocyclopropane-1-carboxylate synthase (PHACS) |
| Gene ID | 84680 |
| Immunogen | PHACS (NP_115981, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAM ISSDTSYLSSRGRMIKWFWDSAEEGYRTYHMDEYDEDKNPSGIIN* |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG3 Kappa »Matching secondary antibodies |
| Description | 1-aminocyclopropane-1-carboxylate synthase Mouse monoclonal antibody raised against a partial recombinant PHACS. Synonyms: ACS |
| Clone | 1D2 |
| Host | Mouse |
Application Details: 1-aminocyclopropane-1-carboxylate synthase (PHACS) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: 1-aminocyclopropane-1-carboxylate synthase (PHACS) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) . |








