You are here: Homepage » Product details for "1aminocyclopropane1carboxylate synthase PHACS Human"

Product details for 1-aminocyclopropane-1-carboxylate synthase (PHACS) (Human...

Print Version

1-aminocyclopropane-1-carboxylate synthase (PHACS) (Human) antibody

Overview


	Antigen:	1-aminocyclopropane-1-carboxylate synthase (PHACS)
	Antibody Type:	Monoclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN169463
	Availability:	Delivery in 7 to 10 days

Antigen	1-aminocyclopropane-1-carboxylate synthase (PHACS)
Gene ID	84680
Immunogen	PHACS (NP_115981, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAM ISSDTSYLSSRGRMIKWFWDSAEEGYRTYHMDEYDEDKNPSGIIN*
Reactivity	Human
Antibody Type	Monoclonal
Isotype	IgG3 Kappa »Matching secondary antibodies
Description	1-aminocyclopropane-1-carboxylate synthase Mouse monoclonal antibody raised against a partial recombinant PHACS. Synonyms: ACS
Clone	1D2
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (37.11 KDa) .

Image for 1-aminocyclopropane-1-carboxylate synthase (PHACS) (Human) antibody (1)

Google Scholar	Find more references for clone 1D2 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen PHACS (Bioinformatic Harvester (EMBL))