PANIER
AIDE
Antigènes
Détail du produit pour ARP1 actin-related protein 1 homolog A, centractin alpha ...
ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A) (Human) antibody
Aperçu
|
|
| Antigène: | ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A) |
| Type anticorps: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 258,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN171896 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A) (Human) antibody
| Antigène | ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A) |
| ID gène | 10121 |
| Immunogène | ACTR1A (NP_005727, 279 a.a. ~ 376 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) LVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAP QERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKT* |
| Reactivité | Human |
| Type anticorps | Polyclonal |
| Description | ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin. Mouse polyclonal antibody raised against a partial recombinant ACTR1A. Synonyms: ARP1 |
| Hôte | Mouse |
Applications: ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (36.78 KDa) . |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A) (Human) antibody
|
Western Blot detection against Immunogen (36.78 KDa) . |
Informations supplémentaires: ARP1 actin-related protein 1 homolog A, centractin alpha (yeast) (ACTR1A) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour antigène ACTR1A sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène ACTR1A (Bioinformatic Harvester (EMBL)) |
