SUCHTUTORIUM ANZEIGEN Show Tutorial Video
Produktdetails für  ARP1 actin-related protein 1 homolog B, centractin beta (...

ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) (Human) antibody

Übersicht

Antigen: ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B)
Antikörper-Typ: Monoklonal
Applikation: ELISA
Reaktivität: Human
Wirt: Mouse
Menge: 100 µg
Preis: 396,00 €   (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt)
Bestellnummer: ABIN168267
Verfügbarkeit: Delivery in 7 to 10 days
Bestellhinweis Bestellhinweis
In den Warenkorb

Auf dieser Seite

Produktbeschreibung
Anwendungen
Verwandte Produkte
Weitere Informationen

Kundenservice

Technische Anfrage stellen
Produktdetails an Kollegen senden
Datenblatt herunterladen

Produktbeschreibung:  ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) (Human) antibody

zurück nach oben ^


Antigen ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B)
Gen-ID 10120
Immunogen ACTR1B (NP_005726, 191 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) SRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQYTLPD GSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHK*
Reaktivität Human
Antikörper-Typ Monoklonal
Isotyp IgG2a Kappa »Passende Sekundärantikörper
Beschreibung ARP1 actin-related protein 1 homolog B, centractin beta (yeast) This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins are of equal length and share 90% amino acid identity. They are present in a constant ratio of approximately 1:15 in the dynactin complex. Mouse monoclonal antibody raised against a partial recombinant ACTR1B. Synonyms: ARP1B, CTRN2
Klon 40000000000
Wirt Mouse

Anwendungen:  ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) (Human) antibody

zurück nach oben ^


Applikation ELISA
Applikationshinweise Quality Control: Antibody Reactive Against Recombinant Protein on ELISA
Buffer In 1x PBS, pH 7.2
Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Beschränkungen For Research Use only

Weitere Informationen:  ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) (Human) antibody

zurück nach oben ^


Google Scholar Suchen Sie in Google Scholar™ nach weiteren Artikeln für Klon 40000000000
EMBL Harvester Genom von Mensch, Maus oder Ratte nach Antigen ACTR1B durchsuchen (Bioinformatic Harvester (EMBL))