PANIER
AIDE
Antigènes
Détail du produit pour ARP1 actin-related protein 1 homolog B, centractin beta (...
ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) (Human) antibody
Aperçu
| Antigène: | ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) |
| Type anticorps: | Monoclonal |
| Application: | ELISA |
| Reactivité: | Human |
| Hôte: | Mouse |
| Quantité: | |
| Prix: | 396,00 € (Frais d\'envoi , €10.00 glace carbonique et TVA exclus) |
| Numéro de commande: | ABIN168267 |
| Disponibilité: | Delivery in 7 to 10 days |
Description du produit: ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) (Human) antibody
| Antigène | ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) |
| ID gène | 10120 |
| Immunogène | ACTR1B (NP_005726, 191 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) SRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQYTLPD GSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHK* |
| Reactivité | Human |
| Type anticorps | Monoclonal |
| Isotype | IgG2a Kappa »Anticorps secondaires correspondants |
| Description | ARP1 actin-related protein 1 homolog B, centractin beta (yeast) This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins are of equal length and share 90% amino acid identity. They are present in a constant ratio of approximately 1:15 in the dynactin complex. Mouse monoclonal antibody raised against a partial recombinant ACTR1B. Synonyms: ARP1B, CTRN2 |
| Clone | 40000000000 |
| Hôte | Mouse |
Applications: ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) (Human) antibody
| Application | ELISA |
| Indications d'application | Quality Control: Antibody Reactive Against Recombinant Protein on ELISA |
| Buffer | In 1x PBS, pH 7.2 |
| Stock | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Informations supplémentaires: ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) (Human) antibody
| Google Scholar | Trouver des références supplémentaires pour clone 40000000000 sur Google Scholar™ |
| EMBL Harvester | Recherche humain, souris ou rat génome pour antigène ACTR1B (Bioinformatic Harvester (EMBL)) |
