SHOW TUTORIAL VIDEO Show Tutorial Video
Product details for  ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1) (Human) antibody

Overview

Image for ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1) (Human) antibody
Antigen: ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 570,52 $   (Plus shipping costs , $13.07 dry ice fee and VAT, Invoice in EUR)
Order number: ABIN166842
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1) (Human) antibody

back to top ^


Antigen ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1)
Gene ID 4363
Immunogen ABCC1 (NP_004987, 816 a.a. ~ 916 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYA STEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLS*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG1 Kappa »Matching secondary antibodies
Description ATP-binding cassette, sub-family C (CFTR/MRP), member 1 The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternative splicing by exon deletion results in several splice variants but maintains the original open reading frame in all forms. Mouse monoclonal antibody raised against a partial recombinant ABCC1. Synonyms: ABC29, ABCC, DKFZp781G125, GS-X, MRP, MRP1
Clone 1G8
Host Mouse

Application Details:  ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1) (Human) antibody (1)

External Information:  ATP-binding cassette, sub-family C (CFTR/MRP), member 1 (ABCC1) (Human) antibody

back to top ^


Google Scholar Find more references for clone 1G8 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen ABCC1 (Bioinformatic Harvester (EMBL))