Additional Information: CSE1 chromosome segregation 1-like (yeast) (CSE1L) (Human) antibody

Antigen	CSE1 chromosome segregation 1-like (yeast) (CSE1L)
Gene ID	1434
Immunogen	CSE1L (NP_001307, 872 a.a. ~ 972 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKI HLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL
Reactivity	Human
Antibody Type	Monoclonal
Isotype	IgG Mix Kappa »Matching secondary antibodies
Description	CSE1 chromosome segregation 1-like (yeast) Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. Mouse monoclonal antibody raised against a partial recombinant CSE1L. Synonyms: CAS, CSE1, MGC117283, MGC130036, MGC130037, XPO2
Clone	3D8
Host	Mouse

Application Details: CSE1 chromosome segregation 1-like (yeast) (CSE1L) (Human) antibody

Application	Western Blotting (WB), Immunohistochemistry (IHC), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (37.11 KDa) .

Image for CSE1 chromosome segregation 1-like (yeast) (CSE1L) (Human) antibody (1)

Immunoperoxidase of monoclonal antibody to CSE1L (H00001434-M08) on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml]

Image for CSE1 chromosome segregation 1-like (yeast) (CSE1L) (Human) antibody (2)

more...

more...

Google Scholar	Find more references for clone 3D8 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen CSE1L (Bioinformatic Harvester (EMBL))


	Antigen:	CSE1 chromosome segregation 1-like (yeast) (CSE1L)
	Antibody Type:	Monoclonal
	Application:	Western Blotting (WB), Immunohistochemistry (IHC), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	100 µg
	Price:	538,36 $ (Plus shipping costs , $13.59 dry ice fee and VAT, Invoice in EUR)
	Order number:	ABIN165992
	Availability:	Delivery in 7 to 10 days