SHOW TUTORIAL VIDEO Show Tutorial Video
Product details for  D site of albumin promoter (albumin D-box) binding protei...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

D site of albumin promoter (albumin D-box) binding protein (DBP) (Human) antibody

Overview

Image for D site of albumin promoter (albumin D-box) binding protein (DBP) (Human) antibody
Antigen: D site of albumin promoter (albumin D-box) binding protein (DBP)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl (Product variants)
Price: 350,75 $   (Plus shipping costs , $13.59 dry ice fee and VAT, Invoice in EUR)
Order number: ABIN170104
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  D site of albumin promoter (albumin D-box) binding protein (DBP) (Human) antibody

back to top ^


Antigen D site of albumin promoter (albumin D-box) binding protein (DBP)
Gene ID 1628
Immunogen DBP (NP_001343, 226 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) RRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKE NQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL*
Reactivity Human
Antibody Type Polyclonal
Description D site of albumin promoter (albumin D-box) binding protein DBP is a member of the PAR bZIP (proline and acidic amino acid-rich basic leucine zipper) transcription factor family (Khatib et al., 1994). Mouse polyclonal antibody raised against a partial recombinant DBP. Synonyms: DABP
Host Mouse

Application Details:  D site of albumin promoter (albumin D-box) binding protein (DBP) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  D site of albumin promoter (albumin D-box) binding protein (DBP) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for D site of albumin promoter (albumin D-box) binding protein (DBP) (Human) antibody (1)

External Information:  D site of albumin promoter (albumin D-box) binding protein (DBP) (Human) antibody

back to top ^


Google Scholar Find more references for antigen DBP on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen DBP (Bioinformatic Harvester (EMBL))