Product details for D4 GDI (Human) antibody
D4 GDI (Human) antibody
Overview
|
|
| Antigen: | D4 GDI |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB) |
| Reactivity: | Human, Mouse (Murine), Rat, Bovine |
| Host: | Chicken |
| Quantity: | |
| Price: | 426,88 $ (Plus shipping costs and VAT, Invoice in EUR) |
| Order number: | ABIN149766 |
| Availability: | 7 to 10 days until shipment |
Additional Information: D4 GDI (Human) antibody
| Antigen | D4 GDI |
| Immunogen | Synthetic peptide: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDP , corresponding to amino acids 1-62 of Human D4 GDI. |
| Reactivity | Human, Mouse (Murine), Rat, Bovine |
| Antibody Type | Polyclonal |
| Isotype | IgY »Matching secondary antibodies |
| Description | D4 GDI belongs to the family of Rho GDIs or GDP dissociation inhibitors for the Rho/Rac family of small G proteins, consisting of RhoGDI 1, D4 GDI/RhoGDI2 and Rho GDI3. It inhibits the release of GDP from the Rho proteins, essential for GTP loading and activation of GTPase activity. D4 GDI is located in the cytoplasm and in involved in the regulation of the membrane association and dissociation cycle of Rho/Rac proteins. It is known to be a substrate for caspase 3 during Fas mediated apoptosis. |
| Host | Chicken |
Application Details: D4 GDI (Human) antibody
| Application | Western Blotting (WB) |
| Application Notes | WB: Use at a dilution of 1/500. Predicted molecular weight: 23 kDa. Not tested in other applications. Optimal dilutions/concentrations should be determined by the end user. |
| Concentration | 1 mg/ml |
| Purity | Immunogen affinity purified |
| Buffer | Preservative: NoneConstituents: PBS |
| Storage | Store at 4 C. Aliquot and store at -20 C long-term. |
| Restrictions | For research use only |
External Information: D4 GDI (Human) antibody
| Google Scholar | Find more references for antigen D4 GDI on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen D4 GDI (Bioinformatic Harvester (EMBL)) |








