Product details for D4, zinc and double PHD fingers family 2 (DPF2) (Human) a...
D4, zinc and double PHD fingers family 2 (DPF2) (Human) antibody
Overview
|
|
| Antigen: | D4, zinc and double PHD fingers family 2 (DPF2) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 538,36 $ (Plus shipping costs , $13.59 dry ice fee and VAT, Invoice in EUR) |
| Order number: | ABIN167293 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: D4, zinc and double PHD fingers family 2 (DPF2) (Human) antibody
| Antigen | D4, zinc and double PHD fingers family 2 (DPF2) |
| Gene ID | 5977 |
| Immunogen | DPF2 (AAH14889, 56 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) WMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEG LISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARK |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG2a kappa »Matching secondary antibodies |
| Description | D4, zinc and double PHD fingers family 2 The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival factors. It likely serves a regulatory role in rapid hematopoietic cell growth and turnover. This gene is considered a candidate gene for multiple endocrine neoplasia type I, an inherited cancer syndrome involving multiple parathyroid, enteropancreatic, and pituitary tumors. Mouse monoclonal antibody raised against a partial recombinant DPF2. Synonyms: MGC10180, REQ, UBID4, ubi-d4 |
| Clone | 2F6 |
| Host | Mouse |
Application Details: D4, zinc and double PHD fingers family 2 (DPF2) (Human) antibody
| Application | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (34.00 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: D4, zinc and double PHD fingers family 2 (DPF2) (Human) antibody
|
Western Blot detection against Immunogen (34.00 KDa) .
Immunoperoxidase of monoclonal antibody to DPF2 (H00005977-M01) on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 6ug/ml] |








